At-AFP1 (LCR67)

id PHYT00004
Name At-AFP1 (LCR67)
Gene AFP1; Synonyms=LCR67, PDF1.1; OrderedLocusNames=At1g75830ORFNames=T4O12.6, T4O12.7
Family Defensin family
Plant Arabidopsis thaliana (Mouse-ear cress)
Taxonomy Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; eurosids II; Brassicales; Brassicaceae; Arabidopsis;
Activity Antifungal
Target organisms Fungi: Alternaria brassicola (IC50= 10 g/mL), Botrytis cinerea (IC50= 3.90 g/mL), Fusarium culmorum (IC50= 3 g/mL), Fusarium oxysporum (IC50= 3 g/mL), Pyricularia oryzae (IC50= 0.25 g/mL), Verticiliium dahliae (IC50= 1.50 g/mL).
NOTE! Not tested against bacteria.
Description Function:
Possesses antifungal activity sensitive to inorganic cations.
Similarity:
Belongs to the plant defensin family.
Tissue specificity:
Expressed predominantly in seeds.
Subcellular location:
Secreted.
Subunit:
Forms oligomers in its native state.
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
MEDLINE=21016719;PubMed=11130712;DOI=10.1038/35048500
Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S.,White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y.,Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W.,Chung M.K., Conn L., Conway A.B., Conway A.R., Creasy T.H., Dewar K.,Dunn P., Etgu P., Feldblyum T.V., Feng J.-D., Fong B., Fujii C.Y.,Gill J.E., Goldsmith A.D., Haas B., Hansen N.F., Hughes B., Huizar L.,Hunter J.L., Jenkins J., Johnson-Hopson C., Khan S., Khaykin E.,Kim C.J., Koo H.L., Kremenetskaia I., Kurtz D.B., Kwan A., Lam B.,Langin-Hooper S., Lee A., Lee J.M., Lenz C.A., Li J.H., Li Y.-P.,Lin X., Liu S.X., Liu Z.A., Luros J.S., Maiti R., Marziali A.,Militscher J., Miranda M., Nguyen M., Nierman W.C., Osborne B.I.,Pai G., Peterson J., Pham P.K., Rizzo M., Rooney T., Rowley D.,Sakano H., Salzberg S.L., Schwartz J.R., Shinn P., Southwick A.M.,Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D.,Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M.,Wu D., Yu G., Fraser C.M., Venter J.C., Davis R.W.
"Sequence and analysis of chromosome 1 of the plant Arabidopsisthaliana.", Nature 408:816-820(2000).


[2]
IDENTIFICATION.
MEDLINE=21330246;PubMed=11437247;DOI=10.1023/A:1010664704926
Vanoosthuyse V., Miege C., Dumas C., Cock J.M.
"Two large Arabidopsis thaliana gene families are homologous to theBrassica gene superfamily that encodes pollen coat proteins and themale component of the self-incompatibility response.", Plant Mol. Biol. 46:17-34(2001).


[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
MEDLINE=22954850;PubMed=14593172;DOI=10.1126/science.1088305
Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J.,Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F.,Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.,Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J.,Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y.,Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P.,Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F.,Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M.,Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J.,Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T.,Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y.,Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
"Empirical analysis of transcriptional activity in the Arabidopsisgenome.", Science 302:842-846(2003).


[4]
PROTEIN SEQUENCE OF 30-56.
MEDLINE=93138130;PubMed=8422949;DOI=10.1016/0014-5793(93)81299-F
Terras F.R.G., Torrekens S., van Leuven F., Osborn R.W.,Vanderleyden J., Cammue B.P.A., Broekaert W.F.
"A new family of basic cysteine-rich plant antifungal proteins fromBrassicaceae species.", FEBS Lett. 316:233-240(1993).


[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
MEDLINE=96158348;PubMed=8580968DOI=10.1046/j.1365-313X.1996.09010101.x;
Cooke R., Raynal M., Laudie M., Grellet F., Delseny M., Morris P.-C.,Guerrier D., Giraudat J., Quigley F., Clabault G., Li Y.-F., Mache R.,Krivitzky M., Gy I.J.-J., Kreis M., Lecharny A., Parmentier Y.,Marbach J., Fleck J., Clement B., Philipps G., Herve C., Bardet C.,Tremousaygue D., Lescure B., Lacomme C., Roby D., Jourjon M.-F.,Chabrier P., Charpenteau J.-L., Desprez T., Amselem J., Chiapello H.,Hoefte H.
"Further progress towards a catalogue of all Arabidopsis genes:analysis of a set of 5000 non-redundant ESTs.", Plant J. 9:101-124(1996).


[6]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
MEDLINE=99178804;PubMed=10080719;DOI=10.1023/A:1006127302671
Williams R.W., Clark S.E., Meyerowitz E.M.
"Genetic and physical characterization of a region of Arabidopsischromosome 1 containing the CLAVATA1 gene.", Plant Mol. Biol. 39:171-176(1999).


[7]
NUCLEOTIDE SEQUENCE [MRNA], AND TISSUE SPECIFICITY.
PubMed=8989885;DOI=10.1105/tpc.8.12.2309
Penninckx I.A.M.A., Eggermont K., Terras F.R.G., Thomma B.P.H.J.,De Samblanx G.W., Buchala A., Metraux J.-P., Manners J.M.,Broekaert W.F.
"Pathogen-induced systemic activation of a plant defensin gene inArabidopsis follows a salicylic acid-independent pathway.", Plant Cell 8:2309-2323(1996).


Formula C241 H371 N73 O70 S8
Absent amino acids DM
Common amino acids C
Mass (Da) 5686.38
Net charge +6
Isoelectric point 8.41
Basic residues 8
Acidic residues 2
Hydrophobic residues 12
Polar residues 24
Aliphatic residues 6
Tiny residues 11
Boman Index -80.23
Hydropathy Index -0.4
Aliphatic Index 47.84
Instability Index 36.04 (stable)
Half Life Mammalian : 0.8 hour
Yeast : 10 min
E. coli : >10 hour
Extinction Coefficient 8980 M-1 cm-1
Absorbance 280nm 179.6
Composition

Databases

Uniprot:

PDB Structure:

Unknown

Other databases:

EMBL X91916

Sequence:

........10 ........20 ........30 
         |          |          | 
QKLCERPSGTWSGVCGNSNACKNQCINLEK
ARHGSCNYVFPAHKCICYFPC

Signal sequence:

........10 ........20 ........30 
         |          |          | 
MAKSATIVTLFFAALVFFAALEAPMVVEA

Method of sequencing:

Direct sequencing