Antifungal protein AX1

id PHYT00002
Name Antifungal protein AX1
Gene Unidentified
Family Defensin family
Plant Beta vulgaris (Sugar beet)
Taxonomy Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; Caryophyllales; Amaranthaceae; Beta;
Activity Antibacterial, Antifungal
Target organisms Fungi: Cercospora beticola and other filamentous fungi.
NOTE! Little or no effect against bacteria.
Description Function:
Strong inhibiting activity against C.beticola and other filamentous fungi. Little or no effect against bacteria.
Similarity:
Belongs to the plant defensin family.
Tissue specificity:
Leaves and flowers.
Mass spectrometry:
Mass=5078; Mass_error=3; Method=Electrospray; Range=1-46; Source=PubMed:7655063;
[1]
PROTEIN SEQUENCE, AND MASS SPECTROMETRY.
MEDLINE=95383713;PubMed=7655063;
Kragh K.M., Nielsen J.E., Nielsen K.K., Dreboldt S., Mikkelsen J.D.
"Characterization and localization of new antifungal cysteine-richproteins from Beta vulgaris.", Mol. Plant Microbe Interact. 8:424-434(1995).


Formula C214 H336 N64 O64 S8
Absent amino acids HMTY
Common amino acids C
Mass (Da) 5104.68
Net charge +2
Isoelectric point 7.96
Basic residues 8
Acidic residues 6
Hydrophobic residues 12
Polar residues 15
Aliphatic residues 4
Tiny residues 10
Boman Index -93.19
Hydropathy Index -0.46
Aliphatic Index 38.26
Instability Index 66.91 (unstable)
Half Life Mammalian : 4.4 hour
Yeast : >20 hour
E. coli : >10 hour
Extinction Coefficient 6000 M-1 cm-1
Absorbance 280nm 133.33
Composition

Databases

Uniprot:

PDB Structure:

Unknown

Other databases:

HSSP P20158

Sequence:

........10 ........20 ........30 
         |          |          | 
AICKKPSKFFKGACGRDADCEKACDQENWP
GGVCVPFLRCECQRSC

Method of sequencing:

Direct sequencing